BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0397 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 23 2.5 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 7.6 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 345 CRYQLRTATRKRSLLPSATREPDLQPHSSDXTG 443 C+Y R T+ +LL D +P+S D G Sbjct: 82 CKYCNRQFTKSYNLLIHERTHTDERPYSCDICG 114 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.0 bits (42), Expect = 7.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 81 TFIMIY*FVFVLTLF*YPLDVKGC 10 TF +I+ VFV TL L + GC Sbjct: 209 TFAIIHLSVFVYTLVSVILIIMGC 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,580 Number of Sequences: 336 Number of extensions: 2741 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -