BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0392 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 6.4 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 8.5 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 103 IFPSLDRTNYLTYRDLFK 156 IFP +R +++T +D+FK Sbjct: 148 IFPMQERQSWITEQDIFK 165 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 8.5 Identities = 15/64 (23%), Positives = 29/64 (45%) Frame = +3 Query: 255 VYKGLSFESVIASEVSRVPFETLVATKAGNDDCKTLMNNNQVLHLIRTRPQYDVVLVESF 434 V G S++ ++ ++VP++T T G+ +NN + + + R V + Sbjct: 248 VIVGAHSHSLLLNKDAKVPYDTKYDTIEGDYPLVVKKSNNHTVLITQARSFGKYVGRLTV 307 Query: 435 NSDC 446 N DC Sbjct: 308 NFDC 311 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,637 Number of Sequences: 2352 Number of extensions: 13895 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -