BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0387 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 24 1.6 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 24 1.6 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 2.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.6 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 139 VYLGVPLLCILDSIVVATLYRHIQMRRPRK 50 V + PL+ L + V YRH Q RR + Sbjct: 383 VLIIAPLIATLIATVTVNYYRHKQKRRDER 412 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 154 HEPFYAWYDSKNSKSRIDYYGGMVKTYQ 237 HEP A+Y ++N + Y G V Y+ Sbjct: 412 HEPGAAYYQNENMLQKNAEYSGKVGYYE 439 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 154 HEPFYAWYDSKNSKSRIDYYGGMVKTYQ 237 HEP A+Y ++N + Y G V Y+ Sbjct: 360 HEPGAAYYQNENMLQKNAEYSGKVGYYE 387 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = +2 Query: 287 GHNGNRDEQGDVPASQFDARSAPRHPISATGH 382 GH G+ P + P HP+S + H Sbjct: 53 GHGSLLSPSGNTPNKSSTSPYPPNHPLSGSKH 84 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 169 AWYDSKNSKSRIDYYGGM 222 AW+D ++ S +D GGM Sbjct: 188 AWWDVHSTGSWLDMSGGM 205 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -3 Query: 217 LHSNRFLICCSYCRTKHRMAHAVQH 143 +H+N C CR + R H + H Sbjct: 240 IHTNEKPFECDKCRGRFRRRHHLVH 264 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,595 Number of Sequences: 336 Number of extensions: 3956 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -