BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0387 (798 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0152 + 13439178-13439517,13440072-13440229,13440431-134404... 28 7.5 01_06_1467 + 37570289-37570771,37571818-37571892,37572006-37572266 28 7.5 >10_07_0152 + 13439178-13439517,13440072-13440229,13440431-13440477, 13441115-13441178,13441600-13442237,13442328-13442562 Length = 493 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 79 DKGSPPQWSPVYTVKGLLNIPYAELHEP 162 D GS +W P+ G +N P LH P Sbjct: 391 DSGSTSEWRPLIKKYGYVNCPTVRLHIP 418 >01_06_1467 + 37570289-37570771,37571818-37571892,37572006-37572266 Length = 272 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -3 Query: 517 IPFNVFLYLTHIVYLFSLSPTGCTICHLAVSA-SCIVSVPIYLK-SVMSGSTDWMSWS 350 + NV L HI++ SLS G + L V A C++ + LK V++ + W SW+ Sbjct: 179 LTLNVLLLGGHIIFFQSLSLLGYCLFPLDVGALVCMLKDNVILKIIVVTVTLAWSSWA 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,123,040 Number of Sequences: 37544 Number of extensions: 428668 Number of successful extensions: 995 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -