BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbpv0387
(798 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC066979-1|AAH66979.1| 626|Homo sapiens T-cell lymphoma invasio... 30 8.4
>BC066979-1|AAH66979.1| 626|Homo sapiens T-cell lymphoma invasion
and metastasis 2 protein.
Length = 626
Score = 30.3 bits (65), Expect = 8.4
Identities = 11/32 (34%), Positives = 22/32 (68%)
Frame = +3
Query: 339 TQDQLQDIQSVLPDMTDFKYIGTETMQDADTA 434
TQD+++ + LP+M +F+ + ET++D +A
Sbjct: 61 TQDEMESLFGSLPEMLEFRKVFLETLEDGISA 92
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,153,446
Number of Sequences: 237096
Number of extensions: 2402675
Number of successful extensions: 4404
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4404
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9813323168
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -