BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0387 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48245-1|CAA88290.1| 356|Caenorhabditis elegans Hypothetical pr... 28 6.7 Z68106-5|CAA92129.1| 557|Caenorhabditis elegans Hypothetical pr... 28 8.9 >Z48245-1|CAA88290.1| 356|Caenorhabditis elegans Hypothetical protein T27D1.3 protein. Length = 356 Score = 28.3 bits (60), Expect = 6.7 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 445 ICHLAVS--ASCIVSVPIYLKSVMSGSTDWMSWS*SCVELTCRH---VSLFISV 299 + +LAV+ A+ I ++P ++ V GSTDW+ S C CR+ V LF S+ Sbjct: 57 LLNLAVADLANLIFTIPEWIPPVFFGSTDWLFPSFLCP--VCRYLECVFLFASI 108 >Z68106-5|CAA92129.1| 557|Caenorhabditis elegans Hypothetical protein F41E7.6 protein. Length = 557 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +3 Query: 315 ETCLQVNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAK 437 +TCLQ S+Q++ +Q V+P +F G+ + + ++ + Sbjct: 318 KTCLQAESSQNKSSSMQPVMPVKIEFLLTGSVSQKISEAER 358 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,431,423 Number of Sequences: 27780 Number of extensions: 358302 Number of successful extensions: 957 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -