BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0386 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 274 TTGRRLIDEICQIAAYTPKQTYSQ-YIMPYGDLNP 375 TT +LID+ C Y P ++ S Y+ G L P Sbjct: 1197 TTVSQLIDDKCDSGQYYPHESCSSFYVCVNGHLVP 1231 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 275 VSIXQPIESTFLVGDRLASQPVREALQYSLPF 180 VS+ P T LV RL ++PV +A PF Sbjct: 502 VSVATP-NDTSLVRGRLVAKPVADARDAPAPF 532 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,981 Number of Sequences: 336 Number of extensions: 3884 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -