BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0386 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05755.1 68415.m00619 integral membrane family protein contai... 29 3.2 >At2g05755.1 68415.m00619 integral membrane family protein contains Pfam PF00892: Integral membrane protein domain Length = 401 Score = 29.1 bits (62), Expect = 3.2 Identities = 26/95 (27%), Positives = 46/95 (48%) Frame = +1 Query: 223 ASRSPTRKVLSIGWXMDTTGRRLIDEICQIAAYTPKQTYSQYIMPYGDLNPGARRRHNVR 402 AS SP ++ ++ T R L + A+ P+ + S I+P LN R R N+ Sbjct: 2 ASSSPETRIADEHLSLELTVRDLESTALESASSAPELS-SDEIIPL--LNQNQRPRINIF 58 Query: 403 VVTVGRYRMLKDMVSHKILKTKSEISALTDFLDWL 507 + R + + ++ K+ T++EIS +T F W+ Sbjct: 59 SASYTRRKPSEQVI--KV--TETEISPVTQFSSWI 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,689,044 Number of Sequences: 28952 Number of extensions: 320962 Number of successful extensions: 817 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -