BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0334 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 41 7e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 40 0.002 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 39 0.003 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 38 0.009 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.027 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.048 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 34 0.083 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.083 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 33 0.15 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 33 0.19 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 33 0.25 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 33 0.25 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 33 0.25 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.25 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.25 SB_1040| Best HMM Match : RRM_1 (HMM E-Value=1e-05) 32 0.34 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 32 0.45 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 32 0.45 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.78 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 31 1.0 SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 30 1.8 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 2.4 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 29 2.4 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 3.1 SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) 29 3.1 SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) 29 4.1 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 5.5 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 28 5.5 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 28 5.5 SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 28 7.2 SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 92.3 bits (219), Expect = 3e-19 Identities = 47/91 (51%), Positives = 55/91 (60%) Frame = +3 Query: 114 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVEDSPS*GFSS 293 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++GDIYIPRDR T + F Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 294 VVMLKKPWTRWTDECWTAGSFAFRWRDMVAP 386 + C A F FRWRDMV P Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVP 97 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/41 (48%), Positives = 29/41 (70%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 V R GFAF F +RRDAE+A+ +DGR + G+ +RV++A Sbjct: 63 VARNPPGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELA 103 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 V R GFAF F +RRDAE+A+ +DGR + G+ RV++A Sbjct: 33 VARNPPGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELA 73 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +2 Query: 236 SQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 S R R RGFAFV F +++ E+A++ +DG+ DGR ++V A Sbjct: 262 SDRETQRP-RGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQA 305 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RGF FV F + ++A+D DG LDGR ++V A Sbjct: 50 RGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKA 85 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 364 SRGFA+V + + + E+AL MDG +DG+E+ VQ Sbjct: 1197 SRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQ 1231 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RGF FV F + + E+A+D DG+ LDGR ++V A Sbjct: 137 RGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RGF FV F + + E+A+D DG+ DGR ++V A Sbjct: 45 RGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQA 80 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 V R GFAFV + + RDAEEA+ +DG + R +RV+ + Sbjct: 35 VARNPPGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 75 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.9 bits (79), Expect = 0.027 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 269 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 364 FAFV F + RDAE+A+ DG DG +RV+ Sbjct: 302 FAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVE 333 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 35.5 bits (78), Expect = 0.036 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 ESRGF FV + + A++ L M G +DGR++R+ A Sbjct: 325 ESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFA 362 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RG+ FV F + RDAE+A+ ++GR L G + V+ + Sbjct: 722 RGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFS 757 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.1 bits (77), Expect = 0.048 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 SRGF FV F DA+ A+ +++G+ + GR L++ Sbjct: 98 SRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 34.7 bits (76), Expect = 0.063 Identities = 14/39 (35%), Positives = 26/39 (66%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RESRG AF+ F +R+ A+ A+ ++ + + GR ++ +A Sbjct: 48 RESRGVAFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIA 86 Score = 34.3 bits (75), Expect = 0.083 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +3 Query: 153 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 254 V NL Y T DL +VFER G+V + I RD+ T Sbjct: 14 VGNLPYSLTNSDLHKVFERYGKVVKVTILRDKET 47 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 34.3 bits (75), Expect = 0.083 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 R+ R + FV F +R A +A+D ++G +DG +L V +A Sbjct: 32 RKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLA 70 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 34.3 bits (75), Expect = 0.083 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 355 +S+GF FV F +AEEA++ ++G+ + GR L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 S+GF FV F +A +A+ M+GR+L + L V +A Sbjct: 251 SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALA 287 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 34.3 bits (75), Expect = 0.083 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 +S+GF FV F R DA +A+ MD + G++++ A Sbjct: 552 KSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWA 589 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 +S+GFAF+ F R DA A++ + G D L V+ A Sbjct: 220 QSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWA 257 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 33.1 bits (72), Expect = 0.19 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 132 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTG 257 D S+ + NL + E LR +F CG V + + RDR TG Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTG 94 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 242 RSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 + V E RG FVRF +R +A+ A+D ++ + L G +++ Sbjct: 146 KDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKL 185 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 +S G+AFV + DA +A+ M+G L + L+V A Sbjct: 66 QSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 103 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 32.7 bits (71), Expect = 0.25 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 111 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGKVED 269 G R V L V + +DLR +FE G++ ++ I +D+YTG+ +D Sbjct: 160 GTTSVRDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKD 212 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 RGF FV F D A+D M+ L GR +RV +A Sbjct: 46 RGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 ++ + +AFV F ER A +A++ DG+ +DG ++ +A Sbjct: 359 KKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLA 397 >SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 367 RG+AF+ + RD A DG+ +DGR + V + Sbjct: 47 RGYAFIEYEHERDMHAAYKHADGKKIDGRRIVVDV 81 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 132 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 D + L V L+Y TT E L+ F + GE+ + I D TG+ Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGR 68 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 32.7 bits (71), Expect = 0.25 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTGK 260 +L VDNL+ T D+ R F G+V ++I DR TGK Sbjct: 320 TLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGK 358 Score = 31.1 bits (67), Expect = 0.78 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 147 LKVDNLTYRTTPEDLRRVFERCGEVGDI 230 L V +L + TT ++LR FE+CGE+ I Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGELTGI 265 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 S+G+ FV+F E A+ A++ M+G L GR L++ Sbjct: 282 SKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_1040| Best HMM Match : RRM_1 (HMM E-Value=1e-05) Length = 282 Score = 32.3 bits (70), Expect = 0.34 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +2 Query: 251 HRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 H++ +G + F ++D ++AL +DG+ L G+ +R+ Sbjct: 199 HKQKQGEGVIEFATKKDLKKALRKLDGKELKGKRIRL 235 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 251 HRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 H++ +G + F +RD + AL +DG L+G+ +R+ Sbjct: 129 HKQRQGEGVIEFSCKRDLKRALKKLDGEELNGKRIRL 165 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 SRGFAFV + +AE+ +GR ++G +RV Sbjct: 246 SRGFAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 239 QRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 +R SRGF FV + D E+ DG +GR L+V A Sbjct: 75 EREQPERSRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEA 118 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 31.1 bits (67), Expect = 0.78 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 114 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 242 RP ++ L V L TT + L F + GEV D+YIP+ Sbjct: 190 RPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK 232 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDT---MDGRMLDGR 349 R SRGF FVRF + DA+ L T + GR+ + R Sbjct: 153 RRSRGFGFVRFKKDEDAKNVLSTSHRIQGRLCEVR 187 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 248 VHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 ++ + +GFAFV + A+ AL+ M+G +L GR ++V Sbjct: 138 LNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKV 175 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +2 Query: 266 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 367 GF FV F +A +A + ++G ++DGR++ V + Sbjct: 125 GFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSL 158 >SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +3 Query: 141 VSLKVDNLTYR--TTPEDLRRVFERCGEVGDI-YIPRDR 248 +S+K +N R T E+L +FE CG+V D ++P+DR Sbjct: 147 LSVKYNNDKTRESVTEEELTSMFEDCGDVADFRFLPKDR 185 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 416 CDRNDSCMAMRGDHIAPSEREAP--CRPTFVRPSCP 315 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 S+GFAF+ F ++ A++ M+G+ L R + V A Sbjct: 141 SKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYA 177 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 254 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 367 ++S+G V+F +A A++ + G+ML R LRV+M Sbjct: 222 KKSKGMGTVQFETPMEAMNAVNLLHGKMLMDRALRVRM 259 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 144 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 242 +L V N+ TT DL+ FER GEV D+ I + Sbjct: 250 TLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKK 282 >SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) Length = 292 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +2 Query: 269 FAFVRFFERRDAEEALDTMDGR-MLDGRELRVQMA 370 +AFV+F+ + A A + ++G+ ++DG L+VQ A Sbjct: 80 YAFVKFYSAKAALRAKEEVNGKWLIDGNILKVQFA 114 >SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) Length = 1259 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -3 Query: 314 GLLQHHDARKTLRRRILYFPCVPISGNVDITNFSAPFENAA 192 G L+ H T RRILY VP+ GN IT P++ AA Sbjct: 137 GFLRFHVYFTT--RRILYELGVPLPGNSPITQKGNPYKKAA 175 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 257 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 + +GF F+R R AE A +D GR LRV+ A Sbjct: 85 KEKGFGFIRLDTRLHAEAAKAGLDMATRKGRTLRVRFA 122 >SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 233 HSQRSVHRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 H +R ++R FV F A++A+D M+G + +RV MA Sbjct: 133 HVERVNFEKNRSQGFVTFDTWEAADKAIDEMNGLKVQHVHIRVSMA 178 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 361 S GF FV + DA++A+D ++G + + L+V Sbjct: 87 SYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKV 120 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 5.5 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 341 PTFVRPSCP--GLLQHHDARKTLRRRILYFPCVPISGNVDITNFSAPFENAA 192 PTF P G L+ H T RRILY VP+ G+ T P++ AA Sbjct: 142 PTFATPPSVIRGFLRFHVYDTT--RRILYELGVPLPGDSPFTQKGNPYKKAA 191 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +2 Query: 269 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 367 F FV+F + A+EA+ GR+++G+++ V++ Sbjct: 82 FGFVQFETEKGADEAVAKEHGRIINGKKIDVRI 114 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 171 RTTPEDLRRVFERCGEVGDIYIPRDRYT 254 R ED+R FE+ G + D+++ +D+ T Sbjct: 33 RHNAEDIRSAFEQYGTIEDVWVVKDKAT 60 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 260 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 358 S+G+AFV F A+ A DTM M+ GR L+ Sbjct: 138 SKGYAFVEFACDEVAKIAADTMHNYMMFGRLLK 170 >SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -1 Query: 364 LNAKLPAVQHSSVHRVQGFFSITTLEKPYEGESSTFPVYRSLGM 233 L KL +QH++V + + + L+ P + + + RSLGM Sbjct: 74 LKIKLEGLQHNAVKAIVDYLYTSCLDVPADSVLNVYLAARSLGM 117 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 263 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 370 +G+ F + ++ A A+ ++G L+GR LRV A Sbjct: 66 KGYGFCEYKDQETALSAMRNLNGYELNGRALRVDSA 101 >SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1401 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 317 PGLLQHHDARKTLRRRILYFPCVPISGNVDITNFSAP 207 PG + HH K RR P +P+S V T SAP Sbjct: 847 PGEIHHHHHFKNTGRRSKSSPEIPVSPTVLGTTASAP 883 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,139,333 Number of Sequences: 59808 Number of extensions: 332892 Number of successful extensions: 806 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -