BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0334 (634 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. 27 0.49 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 0.86 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 26 1.1 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.5 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 25 2.0 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 3.5 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 6.1 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 8.1 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 8.1 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 8.1 >Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 27.1 bits (57), Expect = 0.49 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -1 Query: 352 LPAVQHSSVHRVQGFFSITTLEKPYEGESSTFPVYRSLG 236 LP Q+ HR+ G F I E PY+ F +R G Sbjct: 38 LPRPQYDVGHRIVGGFEIDVSETPYQVSLQYFNSHRCGG 76 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 0.86 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 443 GTPXLWAR-PCDRNDSCMAMRGDHI 372 GTP R PC N +CM M GD + Sbjct: 768 GTPYDCKRCPCPNNGACMQMAGDTV 792 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 349 PAVQHSSVHRVQGFFSITTLEKPYE 275 P H S HR+ G F I + PY+ Sbjct: 32 PRSPHGSGHRIVGGFEINVSDTPYQ 56 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 117 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 239 PPP+ + + + L + T E V ++C E G I+ P Sbjct: 756 PPPKPPTVTMMDMQQLDTQPTLEFKELVSQKCAERGIIFAP 796 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 352 LPAVQHS-SVHRVQGFFSITTLEKPYE 275 LP H+ S HR+ G F I E PY+ Sbjct: 37 LPRPHHTVSNHRIVGGFEIDVAETPYQ 63 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 77 ELNIYTIQNELRKTSATNRWHGL 145 +L + I N + TSA WHGL Sbjct: 122 DLIVVDITNAMAGTSAAIHWHGL 144 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 101 NELRKTSATNRWHGLV 148 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 334 SSVHRVQGFFSITTLEKPYEGESSTFPVYRSLG 236 S+ HRV G F I + PY+ F +R G Sbjct: 46 SNGHRVVGGFQIDVSDAPYQVSLQYFNSHRCGG 78 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 334 SSVHRVQGFFSITTLEKPYEGESSTFPVYRSLG 236 S+ HRV G F I + PY+ F +R G Sbjct: 46 SNGHRVVGGFQIDVSDAPYQVSLQYFNSHRCGG 78 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 343 VQHSSVHRVQGFFSITTLEKPY 278 ++H+ + R F ++TT E PY Sbjct: 101 IEHAELIRSVDFETVTTFEPPY 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,811 Number of Sequences: 2352 Number of extensions: 11796 Number of successful extensions: 22 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -