BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0332 (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.1 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 8.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 8.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 49 EVTQILYSNIQKLLPTQESRDLAEAIHSXVQKKLRXQKXXDEKELRVVYQK 201 EV Q+ +QK L T+E +DL + KL + + R + Q+ Sbjct: 19 EVAQVWEQTLQKGLDTEEIKDLLQKYPPIANCKLVQAPKLNAEVKRAITQQ 69 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 596 IQLPKRXNPRLLFWKIR 646 I+ KR NP + W+IR Sbjct: 121 IEQYKRENPSIFSWEIR 137 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 258 QIVQLXPQELDERCDSCDQL 199 QIV + + D+ CD CD + Sbjct: 511 QIVDICIRSHDKLCDVCDSV 530 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,741 Number of Sequences: 336 Number of extensions: 2470 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -