BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0332 (794 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0735 + 5431900-5432044,5432137-5432271,5432710-5432750,543... 29 5.6 >06_01_0735 + 5431900-5432044,5432137-5432271,5432710-5432750, 5433463-5433579,5433779-5433898,5433982-5434076, 5434149-5434242,5434592-5434723,5435191-5435303, 5435443-5435566,5435884-5436000,5436083-5436177, 5436269-5436362,5436655-5436780,5436854-5436966, 5437067-5437256,5437395-5437508,5437551-5437598 Length = 670 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +2 Query: 452 LXEVPSKLRAVVVNGQHIFRSTVATHLSQGTVATYWRTXTSXENFTLLIQLPKRXN 619 L + S + + V G F + +HL GT+ R T ++ ++L +R N Sbjct: 400 LVNIGSGVSMIEVTGNGKFERIIGSHLGGGTILGLARLLTGCSSYDEFLELSQRGN 455 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,870,123 Number of Sequences: 37544 Number of extensions: 280590 Number of successful extensions: 549 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -