BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0332 (794 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U62892-1|AAC47284.1| 3351|Drosophila melanogaster retinoid- and ... 33 0.45 AE014135-185|AAF59387.2| 3351|Drosophila melanogaster CG11064-PA... 33 0.45 >U62892-1|AAC47284.1| 3351|Drosophila melanogaster retinoid- and fatty acid-bindingglycoprotein protein. Length = 3351 Score = 33.1 bits (72), Expect = 0.45 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 511 FDGRHSPFXGNCRYVLAHXHVXRKLHAANPTSKTGKPKALILEDKNG 651 FDG + + GNC+Y+LA V + GK K++ L D+ G Sbjct: 2799 FDGLNFAYPGNCKYILAQDSVDNNFTIIGQLT-NGKLKSITLIDREG 2844 >AE014135-185|AAF59387.2| 3351|Drosophila melanogaster CG11064-PA protein. Length = 3351 Score = 33.1 bits (72), Expect = 0.45 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 511 FDGRHSPFXGNCRYVLAHXHVXRKLHAANPTSKTGKPKALILEDKNG 651 FDG + + GNC+Y+LA V + GK K++ L D+ G Sbjct: 2799 FDGLNFAYPGNCKYILAQDSVDNNFTIIGQLT-NGKLKSITLIDREG 2844 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,714,069 Number of Sequences: 53049 Number of extensions: 454082 Number of successful extensions: 1219 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3695805360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -