BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0330 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32117| Best HMM Match : DUF1143 (HMM E-Value=7.7) 28 5.7 SB_690| Best HMM Match : GCS (HMM E-Value=0) 27 9.9 >SB_32117| Best HMM Match : DUF1143 (HMM E-Value=7.7) Length = 755 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Frame = +3 Query: 204 PWSIPPCLAARRPNA-----PLQRMPSHLI 278 PW + CLA RRP++ P+ RMP L+ Sbjct: 164 PWKLVYCLATRRPDSETTLLPMDRMPFGLL 193 >SB_690| Best HMM Match : GCS (HMM E-Value=0) Length = 560 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 214 MDQGFIWKHIENFINSALFKSFHHIFITFTMSL 116 MDQ + +EN I+ AL + + H+FI M+L Sbjct: 445 MDQEIYQQLVENGIDDALARHYAHLFIRDPMTL 477 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,343,784 Number of Sequences: 59808 Number of extensions: 298991 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -