BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0324 (843 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 2.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 5.3 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 7.0 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 212 WMQKATEHVIGCVLCSP 228 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 526 WMQKATEHVIGCVLCSP 542 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 786 WLQKATEHVIGCVLCSP 802 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 786 WLQKATEHVIGCVLCSP 802 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 759 WMQKATEHVIGCVLCSP 775 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 759 WMQKATEHVIGCVLCSP 775 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 786 WLQKATEHVIGCVLCSP 802 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 117 WAPVTTEHQVGCELIHP 167 W TEH +GC L P Sbjct: 786 WLQKATEHVIGCVLCSP 802 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 111 CLWAPVTTEHQVGCELIHPSYQ*KINKKLPFAA 209 C ++PV+ E+ SY KI PF A Sbjct: 41 CQYSPVSNSDSENSEVSSNSYTPKIKSCRPFKA 73 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 55 YTETLELTS*GGWRI 99 Y E +EL GGW++ Sbjct: 299 YNEIVELQKEGGWKV 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,252 Number of Sequences: 336 Number of extensions: 2729 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -