BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0324 (843 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88315-2|AAB42370.2| 434|Caenorhabditis elegans Hypothetical pr... 55 7e-08 U88315-1|AAM29668.1| 457|Caenorhabditis elegans Hypothetical pr... 55 7e-08 >U88315-2|AAB42370.2| 434|Caenorhabditis elegans Hypothetical protein C37H5.6b protein. Length = 434 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = +3 Query: 567 GTXPXVTSSNCSIGGVLTGLGLPPNVIGNVLGRRXGVHDALGDGXXPT 710 GT P VTSSN ++GG TG+G+PP +GNV+G +G G PT Sbjct: 241 GTYPYVTSSNSTVGGACTGIGVPPTAVGNVIGVVKAYQTRVGTGPFPT 288 >U88315-1|AAM29668.1| 457|Caenorhabditis elegans Hypothetical protein C37H5.6a protein. Length = 457 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = +3 Query: 567 GTXPXVTSSNCSIGGVLTGLGLPPNVIGNVLGRRXGVHDALGDGXXPT 710 GT P VTSSN ++GG TG+G+PP +GNV+G +G G PT Sbjct: 264 GTYPYVTSSNSTVGGACTGIGVPPTAVGNVIGVVKAYQTRVGTGPFPT 311 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,527,780 Number of Sequences: 27780 Number of extensions: 251964 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2087513582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -