BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0324 (843 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57610.1 68416.m06418 adenylosuccinate synthetase (ADSS) iden... 49 3e-06 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 28 8.9 >At3g57610.1 68416.m06418 adenylosuccinate synthetase (ADSS) identical to adenylosuccinate synthetase, chloroplast precursor (EC 6.3.4.4) (IMP-- aspartate ligase) (AdSS) (AMPSase) (Swiss-Prot:Q96529) [Arabidopsis thaliana] Length = 490 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = +3 Query: 567 GTXPXVTSSNCSIGGVLTGLGLPPNVIGNVLGRRXGVHDALGDGXXPT 710 GT P VTSS+ S GG+ TGLG+ P+V+G+++G +G G PT Sbjct: 298 GTYPFVTSSSPSAGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPT 345 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 619 VNTPPMLQFDDVTXGXVPEINKKI 548 +N PP L+FD G V E+ K++ Sbjct: 390 LNNPPSLEFDQSRGGDVEEVEKEV 413 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,556,033 Number of Sequences: 28952 Number of extensions: 231743 Number of successful extensions: 321 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 320 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -