BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0322 (847 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0502 + 21493442-21494341 30 2.7 06_03_0279 + 19100499-19100927 30 2.7 05_05_0385 + 24566916-24567503,24568609-24568824,24568916-245692... 29 4.7 03_06_0271 - 32773895-32774608 29 4.7 01_06_0933 - 33161687-33162205,33162290-33162376,33162459-331626... 29 4.7 07_03_0283 + 16241231-16241625,16241774-16241783 29 6.2 02_05_0817 + 31994241-31995908 28 8.1 >06_03_0502 + 21493442-21494341 Length = 299 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 499 LRCQXPGATRXPXISWMRHHDEDGSTENFMDRRATYSPE 615 + + P TR P W+R DED E F D PE Sbjct: 202 VEARRPATTREPPRVWLRVADEDPEPEEFDDEADDDEPE 240 >06_03_0279 + 19100499-19100927 Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 164 PAEVLFREGQATRLECATEGDDSGVEYSWRKTACILASVKTRSPLSTLALLC 319 PA+VL G+ T + C D+G+ S A + SPL+ L+ LC Sbjct: 22 PAQVLASSGRHTMMRCVGRDGDNGLRRS-EHVVAERAEEEKPSPLNALSHLC 72 >05_05_0385 + 24566916-24567503,24568609-24568824,24568916-24569241, 24569906-24570338,24570769-24571281 Length = 691 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 242 YSWRKTACILASVKTRSPLSTLALLCSAKPKLRTKASTSASP 367 Y RKT L+ ++ R PLS + L K +L T TS P Sbjct: 644 YKHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKP 685 >03_06_0271 - 32773895-32774608 Length = 237 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = +2 Query: 194 ATRLECATEGDDSGVEYSWRKTACILASVKTRSPLS-TLALLCSAKPKLRTKASTSASPK 370 AT+ +C GDD GV AS T+A+ + P + A+T+A+ + Sbjct: 2 ATKRKCPANGDDGGVADLEPVAGGSFASPPPEKKAKLTVAVAVAVAPSSSSSATTAAAGE 61 Query: 371 ATLGSPAQGLLSSAR 415 AT G + AR Sbjct: 62 ATAKREHGGFFAFAR 76 >01_06_0933 - 33161687-33162205,33162290-33162376,33162459-33162695, 33162778-33162886,33162997-33163313,33163398-33163607, 33165380-33165901 Length = 666 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 242 YSWRKTACILASVKTRSPLSTLALLCSAKPKLRTKASTSASP 367 Y RKT L+ ++ R PLS + L K +L T TS P Sbjct: 617 YKHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKP 658 >07_03_0283 + 16241231-16241625,16241774-16241783 Length = 134 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -2 Query: 219 SVAHSSLVACPSLNNTSAGASLRTGTLSPELTGC 118 +VA ++VAC + ++S+ + L GT++ L+GC Sbjct: 11 AVAAMAVVACFAATSSSSSSQLHCGTVTSLLSGC 44 >02_05_0817 + 31994241-31995908 Length = 555 Score = 28.3 bits (60), Expect = 8.1 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = -2 Query: 234 PLSSPSVAHSSLVACPSLNNTSAGASLRTGTLSPELTGCPVV*ITHVPKTNNVQE 70 PLSS + AHS+ + P LN TS R L P L + THV N+Q+ Sbjct: 21 PLSSLAAAHSANRSSPRLNPTSVPPPPRQLHL-PTLQARRLCSTTHVVLPTNLQD 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,449,786 Number of Sequences: 37544 Number of extensions: 458320 Number of successful extensions: 1365 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -