BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0317 (761 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39998-5|AAK71421.2| 408|Caenorhabditis elegans Gustatory recep... 30 2.1 Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical pr... 28 8.3 >U39998-5|AAK71421.2| 408|Caenorhabditis elegans Gustatory receptor family protein 5 protein. Length = 408 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 443 LNSKTRRFYELCNFDFIYFTFESVFNIFYNLK 538 L SKTR+FY+ + I + ++FN+ Y+ K Sbjct: 138 LRSKTRKFYDGARWFIILYVITTLFNVVYSGK 169 >Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical protein F42E11.3 protein. Length = 258 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 473 VHRTVSFLNSVKSPFGX*N*LVFTFWFIKYFLHVKNFFFS 354 V R + +L + FG L +TF+ I + +H K FF S Sbjct: 19 VFRKIHYLELLSQMFGF---LFYTFYLIIFLVHGKTFFIS 55 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,980,703 Number of Sequences: 27780 Number of extensions: 247792 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -