BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0314 (881 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 27 0.26 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.4 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 7.3 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 22 7.3 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 22 7.3 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 26.6 bits (56), Expect = 0.26 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 160 ANYQDDQSRNGKQKIEAKHEVLYTGHSTFESHCYSIKYYRQIVLLRNK 17 A++ D GK + + K+ V+YT H E YY + + +R K Sbjct: 141 ADFADAPDAIGKTRTKDKYRVVYTDHQRVELE--KEFYYSRYITIRRK 186 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +2 Query: 527 NSPADWADHGL---PIPSTCWLRPRRSMTASSXAAPRTRPTS 643 N AD A + + P+P T R ++T P T+PT+ Sbjct: 146 NEEADAASNVISSTPLPPTTSTTTRTTLTTKFTTKPSTKPTN 187 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 7.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 180 EFISALMPTIRMINPVMANRRLKQNMRYFTQDIPP 76 E SAL + NRR+KQ R IPP Sbjct: 285 EIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPP 319 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.8 bits (44), Expect = 7.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 180 EFISALMPTIRMINPVMANRRLKQNMRYFTQDIPP 76 E SAL + NRR+KQ R IPP Sbjct: 74 EIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPP 108 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.8 bits (44), Expect = 7.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 180 EFISALMPTIRMINPVMANRRLKQNMRYFTQDIPP 76 E SAL + NRR+KQ R IPP Sbjct: 74 EIASALQLNETQVKIWFQNRRMKQKKRMKEGLIPP 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,314 Number of Sequences: 336 Number of extensions: 3983 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -