BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0314 (881 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||M... 30 0.50 SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|ch... 26 8.2 SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharo... 26 8.2 >SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 685 Score = 29.9 bits (64), Expect = 0.50 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 372 RWLHEAYGLGRFGVFXILGAQPERFHYSISGRQER 476 R++HEA+G+ FG E+FH++ SG +R Sbjct: 629 RYVHEAFGMHTFGDSGPAPKLYEKFHFTTSGVAQR 663 >SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.8 bits (54), Expect = 8.2 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -2 Query: 238 ENDRSELVEVLIGEVHVRIRVYFSPDAN 155 E+ E++E GE + +R++F+P+A+ Sbjct: 76 ESPPFEVIETGWGEFDIMVRIFFAPEAH 103 >SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 25.8 bits (54), Expect = 8.2 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +2 Query: 77 GGMSCVKYLMFCFNLLFAITGLIILIVGIRAEINSYPYMNFTDENFYKFAPIVLIIVGIM 256 GG+ +L F + ++FA T ++LI+ +R + P D + K + +GI+ Sbjct: 351 GGIGSSDFLNFLYGIIFAGTAGMMLILSLRVIL---PEALRHDHSENKRHSFICFTIGIL 407 Query: 257 F 259 F Sbjct: 408 F 408 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,336,458 Number of Sequences: 5004 Number of extensions: 63674 Number of successful extensions: 179 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 179 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -