BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0314 (881 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0386 + 18429675-18430679,18431001-18431111,18431139-184311... 29 3.7 09_06_0111 - 20924838-20924969,20925147-20925290,20925391-209254... 29 3.7 >12_02_0386 + 18429675-18430679,18431001-18431111,18431139-18431195, 18431552-18431589,18431688-18431733,18431811-18431849 Length = 431 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 250 HYVFIVAFFGCCGAVKENHCMIXTFSV 330 HY +V +G G ++E HC + T V Sbjct: 242 HYACVVDLYGRAGLIEEAHCFVKTMPV 268 >09_06_0111 - 20924838-20924969,20925147-20925290,20925391-20925453, 20925993-20926116,20926779-20927005,20927088-20927255, 20927348-20927498,20927567-20927889 Length = 443 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 6/72 (8%) Frame = +1 Query: 355 ELAVGIAGYMKHTDLEDSGFXKFWGRNLNA------SITXYPVDKNVQKTIDIIPTDXXA 516 ELA GIA +K+ + D+ F ++ +N+ A S Y + ++ + +++ D Sbjct: 257 ELASGIAEVVKYGLIRDAPFFEWQEKNMPALLAREPSALAYAIKRSCENKAEVVAQDEKE 316 Query: 517 AGIKQSGRLGRS 552 +G++ + LG + Sbjct: 317 SGLRATLNLGHT 328 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,540,397 Number of Sequences: 37544 Number of extensions: 453729 Number of successful extensions: 1034 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -