BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0311 (893 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 51 1e-08 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 5.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 7.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 50.8 bits (116), Expect = 1e-08 Identities = 26/67 (38%), Positives = 38/67 (56%) Frame = +1 Query: 73 PIVLVLAPTRELAQQIQQVANEFGQSIHVRNTCIFGGAPKGPQGRCLERGVEIVIATPGR 252 P+V++++PTRELA QI +F + V+ I+GG Q + G I++ATPGR Sbjct: 236 PVVVIMSPTRELAIQIADQGKKFAYNSTVKVAVIYGGTSTNHQRGRILGGCHILVATPGR 295 Query: 253 LLIFWRR 273 L F R Sbjct: 296 LKDFVNR 302 Score = 46.4 bits (105), Expect = 3e-07 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 4/57 (7%) Frame = +3 Query: 258 DFLEKETTNLRRCTYLVLDEADRMLDMGFEPQIRKII-EQIRP---DRQVLMWSATW 416 DF+ + + Y VLDEADRMLDMGF + +++ Q P +RQ LM+SAT+ Sbjct: 298 DFVNRGNVSFNSLKYFVLDEADRMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATF 354 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 5.6 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 515 PQHPPDC 535 P+HPPDC Sbjct: 357 PRHPPDC 363 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 731 WLXSCPPRGMPRXRQPAT 678 WL S PR +P P+T Sbjct: 24 WLNSQQPRNVPNFAAPST 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,153 Number of Sequences: 336 Number of extensions: 4664 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24823920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -