BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0301 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosac... 27 2.9 SPBC32F12.02 |rec14||recombination protein Rec14|Schizosaccharom... 25 8.7 >SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 586 Score = 27.1 bits (57), Expect = 2.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 46 LHCVPLDPPALANIEASVCRISLTGHAPIVIASVYLPPDKIVLS 177 L CV P++ E +C+ + TGH +++ P K ++S Sbjct: 487 LQCVSNVAPSMYK-EGGICKQTFTGHKDFILSVTVSPDGKWIIS 529 >SPBC32F12.02 |rec14||recombination protein Rec14|Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 25.4 bits (53), Expect = 8.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 112 LTGHAPIVIASVYLPPDKIVLSSDIEALLGI 204 L GHA + A + P ++LS+D+E + I Sbjct: 225 LRGHAAWIFAVAFNPVGDLLLSADVEGKIKI 255 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,510,767 Number of Sequences: 5004 Number of extensions: 45185 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -