BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0298 (385 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 25 0.72 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 25 0.72 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 25 0.95 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 24 2.2 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 24 2.2 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 24 2.2 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 23 2.9 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 23 3.8 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 23 5.1 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 6.7 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 22 6.7 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 22 6.7 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 22 6.7 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 22 6.7 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 22 6.7 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 22 6.7 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 22 8.9 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 22 8.9 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 22 8.9 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 22 8.9 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 22 8.9 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 22 8.9 AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 22 8.9 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 0.72 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H L+ T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCLQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 0.72 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H L+ T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCLQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.0 bits (52), Expect = 0.95 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H L+ T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCLQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H L+ T PP + S+ AA A+ + N N + G N Sbjct: 10 CVSHCLQYILTEGPPAKKTSNTANATTGAANAITNNATNGNSVANAGSN 58 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAASAVTNNATNGNSVANAGSN 58 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNSVANAGSN 58 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 2.2 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNSVANAGSN 58 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNSVANAGSN 58 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.4 bits (48), Expect = 2.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 58 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.0 bits (47), Expect = 3.8 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 12 CVSHCXQYILTEGPPAKKTSSTANATTGAANAITNNATNGNSVANAGSN 60 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNNATNGNIVANAGSN 58 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.6 bits (46), Expect = 5.1 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 81 CWAVSLFSFVLERVKRTGRTRSS 13 CW +++S R R RTR S Sbjct: 20 CWDCTVWSMASNRTVRCPRTRRS 42 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.2 bits (45), Expect = 6.7 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNNATNGNIVANAGSN 58 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 22.2 bits (45), Expect = 6.7 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 12 CVSHCXQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 60 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.2 bits (45), Expect = 6.7 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNTATNGNIVANAGSN 58 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.2 bits (45), Expect = 6.7 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.2 bits (45), Expect = 6.7 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA AV + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAVTNTATNGNIVANAGSN 58 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 22.2 bits (45), Expect = 6.7 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCFQYILTEGPPAKKTSSTANATTGAANAITNTATNGNIVANAGSN 58 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 21.8 bits (44), Expect = 8.9 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 162 LSACSSLYET*PLPPRXRHKIYNC*R 85 L A S+ YE+ LP R R Y C R Sbjct: 150 LLAVSNAYESIELPSRDRSLEYICVR 175 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 21.8 bits (44), Expect = 8.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAITNNATNGNIVANAGSN 58 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 21.8 bits (44), Expect = 8.9 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 33 CV*HALKQKKTTKPPNRTVSSCIFCDVXAAEAV-RSRINWNKRSICGEN 176 CV H + T PP + SS AA A+ + N N + G N Sbjct: 10 CVSHCXQYILTEGPPAKKTSSTANATTGAANAITNTATNGNIVANAGSN 58 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 20 RVRPVRLTRSKTKENNETA 76 RV P+R K NNETA Sbjct: 1903 RVLPIREPPVKLNSNNETA 1921 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 362 CQTPA**ATQFLRECHMEXG 303 CQ A +FLREC E G Sbjct: 242 CQDECVLAGRFLRECFYEGG 261 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 362 CQTPA**ATQFLRECHMEXG 303 CQ A +FLREC E G Sbjct: 242 CQDECVLAGRFLRECFYEGG 261 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 312 HMAFPKKLRCLSGGGLAELDH 374 H+ F L C+S G + +DH Sbjct: 11 HIIFAILLACVSRGSASPIDH 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,803 Number of Sequences: 2352 Number of extensions: 7582 Number of successful extensions: 64 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -