BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0297 (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha... 31 0.24 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 26 6.8 SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2... 25 9.0 >SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccharomyces pombe|chr 2|||Manual Length = 485 Score = 30.7 bits (66), Expect = 0.24 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 81 KLHCFDVAFVNLQLNQQMLIVNSVRR 4 K+HC + F LQ+NQ ++ NS R Sbjct: 268 KVHCLNTLFSKLQINQSIIFCNSTNR 293 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 303 VVPVYGSLKRYPXPAIHPDLYDNILVSI 386 ++P++ S KR+ +P L+DN V I Sbjct: 139 IIPIFKSKKRFMTSHNNPSLHDNFSVRI 166 >SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 825 Score = 25.4 bits (53), Expect = 9.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 686 MMSKXDKVTEFNPENLCRNXPKSGLKAGRVRISP 585 +M+K +VTE E+LC+ + GR I P Sbjct: 480 LMAKRGRVTEVLSEHLCQGFMQGYTLTGRTAIFP 513 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,832,695 Number of Sequences: 5004 Number of extensions: 51613 Number of successful extensions: 120 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -