BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0292 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 29 0.12 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 27 0.85 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 27 0.85 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 27 0.85 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 27 0.85 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 27 0.85 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 27 0.85 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 27 0.85 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 27 0.85 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 25 2.0 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 24 4.5 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 4.5 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 6.0 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 24 6.0 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 24 6.0 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 24 6.0 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 24 6.0 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 24 6.0 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 24 6.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 6.0 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 6.0 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 29.5 bits (63), Expect = 0.12 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 360 TASTRSSDKSPNRHGALRXPFXGGAVRYLGHETSCTRYWTC 482 T++T + R + P GG ++ H T+C RY+ C Sbjct: 450 TSTTTEGNPGTTRPPSGDGPCAGGRYGFVPHPTNCARYYIC 490 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCP 580 C G L++ H C+W + V CP Sbjct: 501 CPPGTLFDPALHICNWADQVK-CP 523 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 298 YWAHGTDCSRYYGCLEGCVKEFKCPDG 324 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 298 YWAHGTDCSRYYGCLEGCVKEFKCPDG 324 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 26.6 bits (56), Expect = 0.85 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 441 YLGHETSCTRYWTCWNGTATEQLASEG 521 Y H T C+RY+ C G E +G Sbjct: 299 YWAHGTDCSRYYGCLEGCVKEFKCPDG 325 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 220 TILALVLHGSSIWAHDVRFIAAR 152 T++A V + S IW H +RF R Sbjct: 761 TVVAKVRYASPIWCHTLRFANRR 783 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +3 Query: 129 RWTSVLVILAAINLTSCAQIED----PCKTKARIVADDKYCDKYWEVT 260 RWT+ + +I + SC Q+E P +KY D W+ T Sbjct: 161 RWTASEICGKSIKVASCCQLEAFLTLPTYGNCLQTIAEKYPDALWQGT 208 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 220 TILALVLHGSSIWAHDVRF 164 TI+A + + SSIWA ++F Sbjct: 766 TIIAGIRYASSIWAESLKF 784 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 376 VQINPPIGTEH 408 V NPP+GTEH Sbjct: 31 VSANPPLGTEH 41 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 181 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 181 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 180 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 180 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 180 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 180 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 213 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 252 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 509 CIGGXLYNEXAHSCDWPEXVXGCPKHPL--CNEDPNXNVP 622 C G L+N CD P V P L NE N P Sbjct: 212 CAPGTLFNPNTRECDHPSKVSCLPVPSLNSVNEPANRAPP 251 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 839,099 Number of Sequences: 2352 Number of extensions: 17584 Number of successful extensions: 119 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -