BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0292 (772 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1... 29 2.6 At5g13290.2 68418.m01527 protein kinase family protein contains ... 29 4.5 >At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1.3) plant glutamate receptor family, PMID:11379626 Length = 860 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 193 SSIWAHDVRFIAARITRTLVQRRPNILYMFFDKI 92 S IWAHD+ F AR + R PN+ ++I Sbjct: 324 SGIWAHDIAFALARAAEVI--RMPNVTSTLLEEI 355 >At5g13290.2 68418.m01527 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 331 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 242 QVLGSD-NGQSVQYDCPNGLVFAGKHRGVTEGCDYPWRSN 358 Q+LGSD NG+ + NGLV A K G EG P S+ Sbjct: 122 QLLGSDLNGKYYKMVLDNGLVVAVKRLGSLEGVGSPESSS 161 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,033,551 Number of Sequences: 28952 Number of extensions: 369311 Number of successful extensions: 942 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -