BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0289 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.8 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 6.8 Identities = 20/73 (27%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Frame = -3 Query: 293 GGXXXHEVSSRT----RANCVIRCRTNLAAQSXTMLASSRIIRRIVRDYFHTLAVTISYY 126 GG H+ SR A CV R ++ + RR R H+LA Sbjct: 13 GGLYYHQRCSRDWFRISAGCVSRISNRISRNRVLLRGQCISSRRNGRHNVHSLAFGAIQL 72 Query: 125 GQYERIPLLEKQK 87 Q + L EK+K Sbjct: 73 RQLLKRQLCEKRK 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,772 Number of Sequences: 438 Number of extensions: 2273 Number of successful extensions: 23 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -