BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0289 (727 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, put... 28 5.5 At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, put... 28 5.5 At5g13950.1 68418.m01631 expressed protein 27 9.6 >At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 219 GPVGNDAGIFENYKTHSSGLLSHVSGDNI 133 GPV ++E++ + SG+ H++G NI Sbjct: 255 GPVEVSFTVYEDFAHYKSGVYKHITGSNI 283 >At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 219 GPVGNDAGIFENYKTHSSGLLSHVSGDNI 133 GPV ++E++ + SG+ H++G NI Sbjct: 255 GPVEVSFTVYEDFAHYKSGVYKHITGSNI 283 >At5g13950.1 68418.m01631 expressed protein Length = 939 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -2 Query: 255 GELRDPXQDESGGPVGNDAGIFENY--KTHSSGLLSHVSGDNI 133 GE +P Q P G D+GIF K HS S GD I Sbjct: 431 GESLNPNQSGDMAPDGEDSGIFSQISGKNHSPSKDSSSYGDQI 473 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,129,891 Number of Sequences: 28952 Number of extensions: 174918 Number of successful extensions: 257 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -