BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0288 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 138 7e-35 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 7.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 7.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 7.1 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 138 bits (333), Expect = 7e-35 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -2 Query: 511 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 332 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTF Sbjct: 68 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTF 127 Query: 331 QQMWIS 314 QQMWIS Sbjct: 128 QQMWIS 133 Score = 136 bits (330), Expect = 2e-34 Identities = 62/67 (92%), Positives = 64/67 (95%) Frame = -3 Query: 711 KLATVXSSSSFEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 532 ++AT SSSS EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 531 DVDIRKD 511 DVDIRKD Sbjct: 61 DVDIRKD 67 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 497 RIVRWYHHVPWNRRPYAK 444 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 497 RIVRWYHHVPWNRRPYAK 444 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 566 MPQASIPKNXGWKRASGQRNLSFPIVMT 649 + Q IP + +G+RN+ PIV + Sbjct: 165 LKQVKIPHDIAINSTTGKRNVVTPIVQS 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,389 Number of Sequences: 438 Number of extensions: 4790 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -