BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0287 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 28 0.30 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 25 3.7 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 6.4 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 23 8.4 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 8.4 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 28.3 bits (60), Expect = 0.30 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 480 QAP*PTSSRTGPRQHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQ 623 Q P + +Q GER + P+ R Q + +HQQ Q R+Q Sbjct: 277 QRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQ 324 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 24.6 bits (51), Expect = 3.7 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -3 Query: 493 GYGACQLAPHEQVVNELGSRARVLQ--SQHRRIXREAGAVHRIDR-EVSP 353 GY Q H QVV +G++ LQ QH+R + H +D+ EV P Sbjct: 158 GYQQQQSQSHRQVV--IGTQQECLQPEQQHQRQQQHTVRRHNVDKVEVIP 205 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 283 DLLQHDEETDPGGSGRVNPVLS 348 D LQ +E P G+GR+ V S Sbjct: 98 DQLQQEETDAPAGAGRIRKVRS 119 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -3 Query: 562 GRARGLMRRSPTTCWRGPVRDEVGYGACQLAPHEQVVNELGSRAR 428 G+ G + ++ TT AC ++ HEQ EL R + Sbjct: 34 GQHYGXLLKASTTWNEKECNGSTKLAACVVSEHEQAYRELKQRCQ 78 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 132 YSKKYVLVKAVVVSQAF 82 YSK Y+L+KA + +Q+F Sbjct: 166 YSKLYLLLKATLSAQSF 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,853 Number of Sequences: 2352 Number of extensions: 13262 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -