BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0284 (837 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.9 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 24 6.6 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 2.9 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Frame = -2 Query: 518 GAIVTSKSAASGKSDDIKFDVGVVENTHFYSSHAVISNSKGTLLDYLLKISR-GGTPSGQ 342 GA+ +SA + I + V H Y H +S ++D ++I + G + Sbjct: 2046 GALTDLRSALVNNT--IFASLAVRHGFHKYFLH--LSPGLQEVIDRFVRIQQENGHRITE 2101 Query: 341 LKFVLKDTIAANGEYKVTGNDGKGNG 264 ++ L D GEY G DG G G Sbjct: 2102 EEYYLPDEDDELGEYGAMGEDGPGEG 2127 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.8 bits (49), Expect = 6.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +1 Query: 616 LSAFSIFLWLKPRHRICRHF 675 + A ++F W+ P IC H+ Sbjct: 135 MGAVTLFYWIAPIPSICAHY 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 838,223 Number of Sequences: 2352 Number of extensions: 17043 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -