BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0284 (837 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC121010-1|AAI21011.1| 571|Homo sapiens kelch-like 28 (Drosophi... 30 9.0 BC121009-1|AAI21010.1| 571|Homo sapiens kelch-like 28 (Drosophi... 30 9.0 >BC121010-1|AAI21011.1| 571|Homo sapiens kelch-like 28 (Drosophila) protein. Length = 571 Score = 30.3 bits (65), Expect = 9.0 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -2 Query: 191 CLMQTSTYIWTLTRTKMTKSVSLRIPRKPINYWNPKTN-WNTAER 60 C++ Y+ T + V++R + WNP TN W + ER Sbjct: 327 CVLDQKVYVIGGIATNVRPGVTIRKHENSVECWNPDTNTWTSLER 371 >BC121009-1|AAI21010.1| 571|Homo sapiens kelch-like 28 (Drosophila) protein. Length = 571 Score = 30.3 bits (65), Expect = 9.0 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -2 Query: 191 CLMQTSTYIWTLTRTKMTKSVSLRIPRKPINYWNPKTN-WNTAER 60 C++ Y+ T + V++R + WNP TN W + ER Sbjct: 327 CVLDQKVYVIGGIATNVRPGVTIRKHENSVECWNPDTNTWTSLER 371 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,323,875 Number of Sequences: 237096 Number of extensions: 2388668 Number of successful extensions: 7825 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7825 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10538170902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -