BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0281 (944 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0001 - 18816492-18816741,18816881-18817050,18817244-188173... 28 9.4 >02_04_0001 - 18816492-18816741,18816881-18817050,18817244-18817388, 18817495-18817565,18817910-18817993,18818103-18818222, 18818310-18818480,18818955-18819044,18821893-18821985, 18822073-18822405 Length = 508 Score = 28.3 bits (60), Expect = 9.4 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = -3 Query: 219 IVRRHFRCQLID*VYLFKLIKRFKIQYLKFKAFSCVKLMKILATFDGRILLPDAILFYGS 40 IV RH L+D Y +K +K F+ K K C+ A G +LL + S Sbjct: 277 IVARHRSQHLVDISYNYKFLKAFETLIEKIKKLKCMSEQPTSA-IRGELLLE----LFSS 331 Query: 39 YET 31 Y+T Sbjct: 332 YDT 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,571,052 Number of Sequences: 37544 Number of extensions: 354011 Number of successful extensions: 603 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2717819680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -