Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0281
         (944 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF100307-1|ABB88211.1|  317|Caenorhabditis elegans Hypothetical ...    29   4.8  

>AF100307-1|ABB88211.1|  317|Caenorhabditis elegans Hypothetical
           protein T12B5.6b protein.
          Length = 317

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 4/67 (5%)
 Frame = -3

Query: 258 FFLLISHPRATSRIVRRHF---RCQLID*-VYLFKLIKRFKIQYLKFKAFSCVKLMKILA 91
           F +L  H R   +I  R+F   RC ++   + +FK  K   +Q ++   FS  +++ IL+
Sbjct: 115 FKILSKHAR---KIAIRNFTENRCDIVTTFIKIFKAEKCIHVQQIELSYFSFDEVLTILS 171

Query: 90  TFDGRIL 70
            FD ++L
Sbjct: 172 WFDAKVL 178


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,150,997
Number of Sequences: 27780
Number of extensions: 328260
Number of successful extensions: 668
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 653
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 668
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2444174194
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)