BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0281 (944 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100307-1|ABB88211.1| 317|Caenorhabditis elegans Hypothetical ... 29 4.8 >AF100307-1|ABB88211.1| 317|Caenorhabditis elegans Hypothetical protein T12B5.6b protein. Length = 317 Score = 29.1 bits (62), Expect = 4.8 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 4/67 (5%) Frame = -3 Query: 258 FFLLISHPRATSRIVRRHF---RCQLID*-VYLFKLIKRFKIQYLKFKAFSCVKLMKILA 91 F +L H R +I R+F RC ++ + +FK K +Q ++ FS +++ IL+ Sbjct: 115 FKILSKHAR---KIAIRNFTENRCDIVTTFIKIFKAEKCIHVQQIELSYFSFDEVLTILS 171 Query: 90 TFDGRIL 70 FD ++L Sbjct: 172 WFDAKVL 178 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,150,997 Number of Sequences: 27780 Number of extensions: 328260 Number of successful extensions: 668 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2444174194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -