BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0281 (944 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transfera... 30 2.6 >At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 168 KLIKRFKIQYLKFKAFSCVKLMKILATFDGRIL 70 +L K+FKI L F FSC LM I + IL Sbjct: 133 RLAKKFKIPKLIFHGFSCFSLMSIQVVRESGIL 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,923,947 Number of Sequences: 28952 Number of extensions: 299279 Number of successful extensions: 515 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2266029384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -