Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0280
         (800 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK128700-1|BAC87578.1|  615|Homo sapiens protein ( Homo sapiens ...    31   6.4  

>AK128700-1|BAC87578.1|  615|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46867 fis, clone UTERU3012293, weakly  similar
           to Homo sapiens zinc finger protein 14 (KOX 6) (ZNF14).
           ).
          Length = 615

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = +2

Query: 368 CSSAYKGNKINNDTTFRCSR-GRMYPTHLSFDCRQRYSMSVACKHQCKDCGFNCFVSNPV 544
           C+  Y       +  + C + G+ Y ++ SF   Q       C ++CK CG    + N +
Sbjct: 125 CAFRYHQRTHTKEKPYACKQCGKAYISYTSFQYHQLNHTGAKC-YECKQCGKGFDLPNSI 183

Query: 545 RF 550
           R+
Sbjct: 184 RY 185


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,366,357
Number of Sequences: 237096
Number of extensions: 2714550
Number of successful extensions: 8759
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8427
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8759
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9869080686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)