BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0280 (800 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060800-1|AAL28348.1| 985|Drosophila melanogaster GH26463p pro... 29 7.4 AE013599-3767|AAF47129.2| 985|Drosophila melanogaster CG3105-PA... 29 7.4 >AY060800-1|AAL28348.1| 985|Drosophila melanogaster GH26463p protein. Length = 985 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +2 Query: 128 IITPNLCHQTSLTKEQLEMKNFFDKIHNGGESRLK*TQIFRVDGDR*VGRIL 283 I+ C T ++L K FFD ++ ES + +++GD GR++ Sbjct: 87 IVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDE--GRVV 136 >AE013599-3767|AAF47129.2| 985|Drosophila melanogaster CG3105-PA protein. Length = 985 Score = 29.1 bits (62), Expect = 7.4 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +2 Query: 128 IITPNLCHQTSLTKEQLEMKNFFDKIHNGGESRLK*TQIFRVDGDR*VGRIL 283 I+ C T ++L K FFD ++ ES + +++GD GR++ Sbjct: 87 IVNNKACQLLGYTSQELRNKGFFDLLNGKTESHISSLAEMQIEGDE--GRVV 136 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,375,255 Number of Sequences: 53049 Number of extensions: 800457 Number of successful extensions: 1728 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1728 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3736869864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -