BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0279 (680 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43800.1 68414.m05046 acyl-[acyl-carrier-protein] desaturase,... 28 6.6 At3g25882.1 68416.m03225 NPR1/NIM1-interacting protein 2 (NIMIN-... 27 8.7 >At1g43800.1 68414.m05046 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Lupinus luteus GI:4704824, Asclepias syriaca GI:1762436, Ricinus communis SP|P22337; contains Pfam profile PF03405 Fatty acid desaturase Length = 391 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 547 ERQDLIEELK-RTASVIEDVPIVIAGKNITEGE-PRYQVM 660 E D + EL+ RTAS+ ++ +V+ G ITE P YQ M Sbjct: 100 EFTDQVRELRERTASLPDEYFVVLVGDMITEDALPTYQTM 139 >At3g25882.1 68416.m03225 NPR1/NIM1-interacting protein 2 (NIMIN-2) identical to cDNA NIMIN-2 protein (nimin-2 gene)GI:12057155 Length = 122 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 159 VENFNAATPFSRNKKEYEIVKVTALFESNKFFNCRGRTRVVTRPV 293 VE N + +R K E+V+ E ++FF R V TR V Sbjct: 11 VEEDNGKSDGNRGKPSTEVVRTVTEEEVDEFFKILRRVHVATRTV 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,988,498 Number of Sequences: 28952 Number of extensions: 266372 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -