BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0278 (726 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g24140.1 68414.m03045 matrixin family protein similar to matr... 50 2e-06 At1g70170.1 68414.m08074 matrixin family protein similar to SP|P... 44 8e-05 At1g59970.1 68414.m06755 matrixin family protein similar to SP|P... 42 4e-04 At2g45040.1 68415.m05607 matrix metalloproteinase nearly identic... 42 6e-04 At4g16640.1 68417.m02515 matrix metalloproteinase, putative meta... 41 0.001 At1g74290.1 68414.m08603 esterase/lipase/thioesterase family pro... 29 2.4 At4g14510.1 68417.m02236 expressed protein contains Pfam domain,... 29 3.1 At3g42070.1 68416.m04317 hypothetical protein 28 7.2 At2g40130.1 68415.m04935 heat shock protein-related contains sim... 28 7.2 At4g39350.1 68417.m05570 cellulose synthase, catalytic subunit (... 27 9.6 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 27 9.6 At2g21770.1 68415.m02588 cellulose synthase, catalytic subunit, ... 27 9.6 >At1g24140.1 68414.m03045 matrixin family protein similar to matrix metalloproteinase [Cucumis sativus] GI:7159629; contains InterPro accession IPR001818: Matrixin Length = 384 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 510 DGFPFDGPGRVVAHAFPPPLGDIHFDDDETW 602 DG PFDGP R +AHAF PP G H D +E W Sbjct: 230 DGEPFDGPMRTLAHAFSPPTGHFHLDGEENW 260 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 331 NKREVTYRLLNGSSTMSKDRIERLLENGLEVWAPHGNLHFTKLDE-GKADIQVYFASGNH 507 N+R++TY + + ++++ ++ + W L FT+++ +DI + F SG H Sbjct: 171 NRRDLTYAF-DPRNALTEE-VKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSGEH 228 Query: 508 ETGSP 522 G P Sbjct: 229 GDGEP 233 >At1g70170.1 68414.m08074 matrixin family protein similar to SP|P29136 Metalloendoproteinase 1 precursor (EC 3.4.24.-) (SMEP1) {Glycine max}; contains InterPro accession IPR001818: Matrixin Length = 378 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = +3 Query: 510 DGFPFDGPGRVVAHAFPPPLGDIHFDDDETWGV 608 DG PFDG +AHAF PP G H D DE W V Sbjct: 226 DGEPFDGVLGTLAHAFSPPSGKFHLDADENWVV 258 >At1g59970.1 68414.m06755 matrixin family protein similar to SP|P29136 Metalloendoproteinase 1 precursor (EC 3.4.24.-) (SMEP1) {Glycine max}; contains InterPro accession IPR001818: Matrixin Length = 360 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 510 DGFPFDGPGRVVAHAFPPPLGDIHFDDDETW 602 DG PFDG +AHA PP G +H D DE W Sbjct: 214 DGEPFDGAMGTLAHASSPPTGMLHLDGDEDW 244 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 334 KREVTYRLLNGSSTMSKDRIERLLENGLEVWAPHGNLHFTKLDEG-KADIQVYFASGNHE 510 KR++TY ++ D ++R+ WA L+FT+ + +ADI + F SG H Sbjct: 156 KRDLTYAFAPQNNLT--DEVKRVFSRAFTRWAEVTPLNFTRSESILRADIVIGFFSGEHG 213 Query: 511 TGSP 522 G P Sbjct: 214 DGEP 217 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 641 LTDFFAVAVHEIGHSLGM 694 + D +VAVHEIGH LG+ Sbjct: 261 VVDLESVAVHEIGHLLGL 278 >At2g45040.1 68415.m05607 matrix metalloproteinase nearly identical to metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 342 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = +3 Query: 510 DGFPFDGPGRVVAHAFPPPLGDIHFDDDETWGV 608 DG PFDG V+AH F P G +H D ETW V Sbjct: 201 DGEPFDGVLGVLAHTFSPENGRLHLDKAETWAV 233 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 647 DFFAVAVHEIGHSLGMSLLTFKSS 718 D +VAVHEIGH LG+ + K + Sbjct: 245 DLESVAVHEIGHVLGLGHSSVKDA 268 >At4g16640.1 68417.m02515 matrix metalloproteinase, putative metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 364 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 510 DGFPFDGPGRVVAHAFPPPLGDIHFDDDETW 602 DG PFDG +AHAF P G +H D ETW Sbjct: 223 DGLPFDGVLGTLAHAFAPENGRLHLDAAETW 253 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/68 (20%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +1 Query: 328 WNKREVTYRLLNGSST--MSKDRIERLLENGLEVWAPHGNLHFTKLDE-GKADIQVYFAS 498 WN+ +TY + ++ + ++ + W+ + F ++D+ AD+++ F + Sbjct: 159 WNRDTLTYAISKTHKLDYLTSEDVKTVFRRAFSQWSSVIPVSFEEVDDFTTADLKIGFYA 218 Query: 499 GNHETGSP 522 G+H G P Sbjct: 219 GDHGDGLP 226 >At1g74290.1 68414.m08603 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 esterase/lipase/thioesterase family Length = 371 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 339 RGHLQTPEWFKYNEQGSHRKASREWFGGLGAPREPPL 449 RG+ + P W + +QG H +R+ G G PL Sbjct: 260 RGYTRKPHWAEVRQQGIHESINRDMIVGFGNWEFDPL 296 >At4g14510.1 68417.m02236 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 932 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 316 IQEGWNKREVTYRLLNGSSTMSKDRIERLLE---NGLEVW 426 IQE W E+ + GSS ++ R+ +LE GL +W Sbjct: 256 IQEKWKGSEIVRLKIEGSSALNMRRMHEILERKTGGLVIW 295 >At3g42070.1 68416.m04317 hypothetical protein Length = 230 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 106 YNMDTYRKIWPELATLTRHN-LFPKRSRKCRPSQG 207 Y +D+++ +W +ATL+R + P R R+ P+ G Sbjct: 195 YVVDSFKSVWNAIATLSRCGCVAPTRRRRHSPALG 229 >At2g40130.1 68415.m04935 heat shock protein-related contains similarity to 101 kDa heat shock protein; HSP101 [Triticum aestivum] gi|11561808|gb|AAC83689 Length = 491 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 85 LTRSIFCYNMDTYRKIWPELATLTRHNLFPKRSRKCRPSQGYHK 216 +T + + T + P L TR +L K S KCRP +G+++ Sbjct: 425 ITGPVSSISDQTQSTLPPWLQMTTRTDLNQKSSAKCRPKKGWNQ 468 >At4g39350.1 68417.m05570 cellulose synthase, catalytic subunit (Ath-A) identical to gi:2827141 Length = 1084 Score = 27.5 bits (58), Expect = 9.6 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 3/87 (3%) Frame = -2 Query: 416 KPFSRSLSMRSLLIVLEPFRSL*VTSRLFHPSCIMYLRFLAA---SLHLYLSNRIFXFE* 246 +P SR L +RS I P+R L + RL + R L + L+L++ I Sbjct: 260 QPLSRKLPIRSSRI--NPYRML-ILCRLAILGLFFHYRILHPVNDAYGLWLTSVICEIWF 316 Query: 245 LLSWFIQYSCLW*PCEGLHFLDRFGNR 165 +SW + W P E +LDR R Sbjct: 317 AVSWILDQFPKWYPIERETYLDRLSLR 343 >At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 958 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 627 LQIYQTQLPRSRHHQNVYR-RVAVETREPLLDQGH 526 LQ++ +LP S H+ NV + + E RE L GH Sbjct: 375 LQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGH 409 >At2g21770.1 68415.m02588 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit, Arabidopsis thaliana (Ath-A) Length = 1088 Score = 27.5 bits (58), Expect = 9.6 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 3/87 (3%) Frame = -2 Query: 416 KPFSRSLSMRSLLIVLEPFRSL*VTSRLFHPSCIMYLRFLAA---SLHLYLSNRIFXFE* 246 +P SR L +RS I P+R L + RL + R L + L+L++ I Sbjct: 265 QPLSRKLPIRSSRI--NPYRML-IFCRLAILGLFFHYRILHPVNDAFGLWLTSVICEIWF 321 Query: 245 LLSWFIQYSCLW*PCEGLHFLDRFGNR 165 +SW + W P E +LDR R Sbjct: 322 AVSWILDQFPKWYPIERETYLDRLSLR 348 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,575,986 Number of Sequences: 28952 Number of extensions: 335815 Number of successful extensions: 973 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -