BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0276 (849 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 36 5e-04 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 33 0.004 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 31 0.013 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 30 0.031 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.5 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.5 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.5 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 1.5 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 1.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 24 1.5 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 24 1.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 1.5 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.5 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.5 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.5 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.5 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 2.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 2.0 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 24 2.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 2.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 2.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 2.7 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 3.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 4.7 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 4.7 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 4.7 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 4.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 4.7 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 6.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.2 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 35.9 bits (79), Expect = 5e-04 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 582 FGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVCD 686 F C +C R LK H R+H+GEKP+ CD Sbjct: 10 FECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCD 44 Score = 33.9 bits (74), Expect = 0.002 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +3 Query: 525 LKQHSKSCLDEGEKDRAGKFGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 LK H + L GEK + C+ C + A L+ H RVH+GE+P+ +C Sbjct: 25 LKTHMR--LHTGEKP----YHCSHCDRQFVQVANLRRHLRVHTGERPYACELC 71 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 639 ERVHSGEKPFFVHVC 683 ER H+GEKPF C Sbjct: 1 ERTHTGEKPFECPEC 15 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 32.7 bits (71), Expect = 0.004 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 588 CTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 CT CS L IH R H+GEKP+ C Sbjct: 178 CTVCSKTFIQSGQLVIHMRTHTGEKPYVCKAC 209 Score = 32.3 bits (70), Expect = 0.006 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 588 CTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 C C LK+H R H+GEKP+ +C Sbjct: 206 CKACGKGFTCSKQLKVHTRTHTGEKPYTCDIC 237 Score = 31.5 bits (68), Expect = 0.010 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 564 KDRAGKFGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 K+ + C C PA L H R H+GEKP+ C Sbjct: 86 KEGEDPYRCNICGKTFAVPARLTRHYRTHTGEKPYQCEYC 125 Score = 30.7 bits (66), Expect = 0.018 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 582 FGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVCD 686 + C CS L +H R+H+ E+P+ VC+ Sbjct: 120 YQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCE 154 Score = 27.1 bits (57), Expect = 0.22 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 582 FGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 + C C + L H R+H+GE+P VC Sbjct: 148 YKCDVCERAFEHSGKLHRHMRIHTGERPHKCTVC 181 Score = 25.0 bits (52), Expect = 0.88 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 525 LKQHSKSCLDEGEKDRAGKFGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 LK H+++ GEK + C C +LK+H+ H GEK + +C Sbjct: 219 LKVHTRT--HTGEKP----YTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC 265 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 31.1 bits (67), Expect = 0.013 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 588 CTQCSYRCQSPAILKIHERVHSGEKPFFVHVCD 686 C C P +L+ H R H+GEKPF C+ Sbjct: 45 CHLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCN 77 Score = 23.0 bits (47), Expect = 3.6 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 Query: 555 EGEKDRAGKFGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVC 683 EG+ ++ F C C S LK+H R H+ P H+C Sbjct: 10 EGQAKKS--FSCKYCEKVYVSLGALKMHIRTHT--LPCKCHLC 48 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 29.9 bits (64), Expect = 0.031 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 582 FGCTQCSYRCQSPAILKIHERVHSGEKPFFVHVCDY 689 F C +CSY C + ++L H + HS + C Y Sbjct: 17 FKCEKCSYSCVNKSMLNSHLKSHSNVYQYRCANCTY 52 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 627 LKIHERVHSGEKPFFVHVCDY 689 L+ H R H G KPF C Y Sbjct: 4 LEYHLRNHFGSKPFKCEKCSY 24 Score = 22.2 bits (45), Expect = 6.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 537 SKSCLDEGEKDRAG--KFGCTQCSYRCQSPAILKIHERVHS 653 +KS L+ K + ++ C C+Y + LK+H R +S Sbjct: 28 NKSMLNSHLKSHSNVYQYRCANCTYATKYCHSLKLHLRKYS 68 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKEREKS 76 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKEREKS 76 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKEREKS 76 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKERERS 76 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKERERS 76 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKERERS 76 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKERERS 76 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRKERERS 76 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 56 RKYRETSKERSRDRTERERS 75 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRTERERS 76 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRKERERS 309 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 279 RKYRETSKERSRDRTERERS 298 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRTERERS 309 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRTERERS 309 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 279 RKYRETSKERSRDRTERERS 298 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRTERERS 309 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 295 RKYRETSKERSRDKTERERS 314 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRTERERS 309 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRKERERS 309 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 57 RKYRETSKERSRDRRERERS 76 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 56 RKYRETSKERSRDRAERERS 75 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 279 RKYRETSKERSRDRRERERS 298 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 342 RKYRETTAEREHEADRRK 395 RKYRET+ ER + R+ Sbjct: 57 RKYRETSKERSQDRTERE 74 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 342 RKYRETTAEREHEADRRK 395 RKYRET+ ER + R+ Sbjct: 57 RKYRETSKERSQDRTERE 74 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 57 RKYRETSKERSRNRTERERS 76 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERSRDRIERERS 309 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 290 RKYRETSKERSRNRTERERS 309 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER R+++ Sbjct: 290 RKYRETSKERSRNRTERERS 309 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET ER + R+++ Sbjct: 57 RKYRETWKERSRDRTERERS 76 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET ER + R+++ Sbjct: 57 RKYRETWKERSRDRTERERS 76 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET ER + R+++ Sbjct: 57 RKYRETWKERSRDRTERERS 76 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET ER + R+++ Sbjct: 57 RKYRETWKERSRDRTERERS 76 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 RKYRET+ ER DRR++ Sbjct: 290 RKYRETSKERSR--DRRER 306 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -3 Query: 559 PSSR--QLFECCFRPRFDGIWRCTYNRRTL 476 P+SR + + CC P D + T R+TL Sbjct: 221 PASRNEEYYPCCTEPYSDITFNITMRRKTL 250 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 R+YRET+ ER + R+++ Sbjct: 57 REYRETSRERSRDRKERERS 76 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 R+YRET+ ER + R+++ Sbjct: 57 REYRETSRERSRDRKERERS 76 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 R+YRET+ ER + R+++ Sbjct: 57 REYRETSRERSRDRKERERS 76 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 R+YRET+ ER + R+++ Sbjct: 57 REYRETSRERSRDRKERERS 76 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQN 401 RKYRET+ ER + R+++ Sbjct: 290 RKYRETSKERFRDRRERERS 309 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 RKYRETTAEREHEADRRKQ 398 +KYRET+ ER + R++ Sbjct: 57 QKYRETSKERSRDRTERER 75 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 553 SRQLFECCFRPRFDGIWRCTYNRRTL 476 + + + CC P D + T R+TL Sbjct: 220 NEKFYTCCDEPYLDITFNITMRRKTL 245 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 553 SRQLFECCFRPRFDGIWRCTYNRRTL 476 + + + CC P D + T R+TL Sbjct: 220 NEKFYTCCDEPYLDITFNITMRRKTL 245 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 553 SRQLFECCFRPRFDGIWRCTYNRRTL 476 + + + CC P D + T R+TL Sbjct: 216 NEKFYTCCDEPYLDITFNITMRRKTL 241 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,889 Number of Sequences: 438 Number of extensions: 3006 Number of successful extensions: 123 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -