BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0272 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 29 0.053 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 8.0 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 28.7 bits (61), Expect = 0.053 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +3 Query: 540 PSWTCTEAV----TYTSPWPLPSARPYQV*WLPCTTSLSTRPFTTH 665 P WT + T TSPW + P TTS +TRP TT+ Sbjct: 1033 PDWTTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTN 1078 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 8.0 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -1 Query: 255 YNLVQATGLRASSGAXPSPTNVNTSNRSEYVSDTDKSKRTIAATSLI 115 Y LV+A G A P N RS+ S K+T+A ++ Sbjct: 140 YTLVKAYGFDGLDLAWEFPENKPKKIRSKLGSIWHSVKKTVAGDKVL 186 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 257 RIIWYKPRDYARPAAPSR 204 R ++YKP D RP +R Sbjct: 497 RFLFYKPEDIFRPNTYNR 514 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,554 Number of Sequences: 336 Number of extensions: 2816 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -