BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0272 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 26 1.1 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 25 3.3 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 3.3 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 26.2 bits (55), Expect = 1.1 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -3 Query: 739 DRCLEIRPSLPHSFNFSKRLVVQWRCVVKGRVLRLVVQGSHQT*YGRADGSG-HGL 575 DRC E+ L H F+ K V W C+ R + ADGSG HGL Sbjct: 345 DRC-ELANDLLHKFHLPKEQVATWVCIAY-HESRFNTSAEGRL---NADGSGDHGL 395 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 228 RASSGAXPSPTNVNTSNRSEYVSDTDKSKRTI 133 R S P +V T R+EY++ +D++ RT+ Sbjct: 254 RRSMRFAPPLVDVATRFRAEYLNSSDRADRTV 285 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 386 RESYALSRSRRDSQALRLETRSDSRHQHSS 475 R+S + SRSR SQA R RS SR + S Sbjct: 1142 RKSGSRSRSRSGSQASRGSRRSRSRSRSRS 1171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,642 Number of Sequences: 2352 Number of extensions: 12956 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -