BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0272 (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.76 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.3 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 5.4 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 5.4 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.4 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.4 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.0 bits (52), Expect = 0.76 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -1 Query: 225 ASSGAXPSPTNVNTSNRSE--YVSDTDKSKRTIAATSL 118 ASS A +PT+V +S RSE V D KR + A L Sbjct: 593 ASSSASSAPTSVCSSPRSEDKEVEDMPVLKRVLQAPPL 630 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 291 KSTPPRNHRARAPSNPGFI*INRNESDRVKLAENRT 398 KS R + R PG + + +ESD +L +RT Sbjct: 1762 KSVSSRRRQQRKQQTPGDVESDESESDPDQLTSSRT 1797 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 291 KSTPPRNHRARAPSNPGFI*INRNESDRVKLAENRT 398 KS R + R PG + + +ESD +L +RT Sbjct: 1758 KSVSSRRRQQRKQQTPGDVESDESESDPDQLTSSRT 1793 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 161 PPNAYRFRPPQNPRF 175 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 161 PPNAYRFRPPQNPRF 175 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 399 PPNAYRFRPPQNPRF 413 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 119 SDVAAIVRFDLSVSDTYSLLLLVFTLVGDGXAP 217 S V ++ +D+S + +LLL++ + G+G P Sbjct: 498 SQVLSMSDYDISNIEHEALLLVITSTFGNGDPP 530 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 134 PPDMYRLRPPPNPRF 148 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 627 CTTSLSTRPFTTHR 668 C T S+ P+ THR Sbjct: 169 CATDFSSWPYDTHR 182 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 382 PPDMYRLRPPPNPRF 396 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 367 PPDMYRLRPPPNPRF 381 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 300 PPRNHRARAPSNPGF 344 PP +R R P NP F Sbjct: 383 PPDMYRLRPPPNPRF 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,131 Number of Sequences: 438 Number of extensions: 3363 Number of successful extensions: 29 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -