BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0270 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 22 4.2 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 22 4.2 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 5.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.8 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 436 GWHCTAKHYSELRSDPGL 383 GW+ ++ YS++ ++PGL Sbjct: 102 GWNEGSQKYSQVAANPGL 119 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 436 GWHCTAKHYSELRSDPGL 383 GW+ ++ YS++ ++PGL Sbjct: 102 GWNEGSQKYSQVAANPGL 119 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.8 bits (44), Expect = 5.6 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 335 IPNLNGMLNWSLFTT 291 +P + GM+NW++ +T Sbjct: 432 LPPIGGMMNWNMPST 446 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = -2 Query: 657 PXGVSSDAKWVK*XREVNLAPKFLQSE 577 P GV ++ +++ EV+++ ++LQ E Sbjct: 1298 PLGVRTNITYIEETSEVHISKEYLQLE 1324 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = -2 Query: 657 PXGVSSDAKWVK*XREVNLAPKFLQSE 577 P GV ++ +++ EV+++ ++LQ E Sbjct: 1298 PLGVRTNITYIEETSEVHISKEYLQLE 1324 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -2 Query: 108 FKDEWHTRCYWEHY*NLILVINFCVMLFSAT 16 F++ W R Y Y + ++ V++F+ T Sbjct: 194 FQEPWGKRAYVTWYSISVFMVPLVVLIFTYT 224 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,546 Number of Sequences: 336 Number of extensions: 3580 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -