BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0270 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0085 + 28264399-28266186 31 1.2 03_05_0181 - 21621561-21621932,21622024-21622329 28 8.3 03_05_0180 + 21593763-21594605 28 8.3 >11_08_0085 + 28264399-28266186 Length = 595 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 307 QFNIPFKFGIEIKSGLIKFRVEPLHPDQDQTLVHYSVWPYSA 432 +F +PF+F + + E LH + D+ LV +W +SA Sbjct: 382 EFRVPFRFQAVVAAKWETVGAEDLHIEPDEVLVVNDLWSFSA 423 >03_05_0181 - 21621561-21621932,21622024-21622329 Length = 225 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 498 STFDNFSSWVLRDCNKGILLLAGTVRPNTIV 406 S DN +S+VL D +G+ + AGT RP V Sbjct: 52 SAADNMASYVL-DLRRGLAVFAGTGRPEEAV 81 >03_05_0180 + 21593763-21594605 Length = 280 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 498 STFDNFSSWVLRDCNKGILLLAGTVRPNTIV 406 S DN +S+VL D +G+ + AGT RP V Sbjct: 72 SAADNMASYVL-DLRRGLAVFAGTGRPEEAV 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,877,908 Number of Sequences: 37544 Number of extensions: 355220 Number of successful extensions: 777 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -