BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0270 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 83 6e-18 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 27 0.76 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 27 0.76 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 27 0.76 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 83.4 bits (197), Expect = 6e-18 Identities = 52/180 (28%), Positives = 85/180 (47%), Gaps = 16/180 (8%) Frame = +1 Query: 13 ESGAEKHYTKVYNQDQVSIMFPVASGMPFIFKYKEPAVIHFQ---------SKLKGKFSF 165 E G + TK Y Q+ V++ FP+A+G+PF + K P ++ F+ S K + Sbjct: 1069 EDGFAYNMTKFYQQNVVTMAFPLATGLPFHYSLKTPTLMKFEFEASATTYPSIFKTPTGY 1128 Query: 166 PSKDNKYYEA-----NMIKDVQFTYARNIDGNVGLWDTLSNQYSSVGVVNKLQFNIPFKF 330 P K+N + N DV Y+R +D VG +Q G K Q +PF F Sbjct: 1129 PEKENDDFIHMPRWFNGSADVNMAYSRLVDAKVGFITPFDHQRYVAGYQKKFQGYLPFSF 1188 Query: 331 --GIEIKSGLIKFRVEPLHPDQDQTLVHYSVWPYSASQKKDSLVAISQDPATKIVERRSK 504 G + ++ + V+PL P +D L H S WPY+ + L +++ P+ I+ R++ Sbjct: 1189 DFGFDFENNDFEVNVQPLEPKKDVLLFHMSSWPYTGYKDIADLRPMAEQPSVHILHDRAQ 1248 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.76 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 87 RCYWEHY*NLILVINF 40 RCY+EHY NL++ F Sbjct: 152 RCYYEHYGNLVVTPQF 167 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 26.6 bits (56), Expect = 0.76 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 87 RCYWEHY*NLILVINF 40 RCY+EHY NL++ F Sbjct: 136 RCYYEHYGNLVVTPQF 151 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.76 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 87 RCYWEHY*NLILVINF 40 RCY+EHY NL++ F Sbjct: 152 RCYYEHYGNLVVTPQF 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,586 Number of Sequences: 2352 Number of extensions: 15314 Number of successful extensions: 28 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -