BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0268 (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0479 - 10775382-10775656,10776513-10777535,10777725-107784... 31 0.91 01_06_1179 - 35161229-35162368 28 8.5 >02_02_0479 - 10775382-10775656,10776513-10777535,10777725-10778461, 10779008-10779155,10779331-10779856 Length = 902 Score = 31.1 bits (67), Expect = 0.91 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 292 VTPIGPFDWMPVPCRLVXP-NAGAXPVYGLSCHGTRTVSFW 173 V P P W P P +V P NAG PV + HG V+ W Sbjct: 855 VLPSVPKAWCPKPLMVVAPANAGTYPV-AIFLHGCNMVNSW 894 >01_06_1179 - 35161229-35162368 Length = 379 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 354 KDRRYNRRTSLELLVLRSGSSLHPSARLTGCQ 259 K RR +RR S++L SGSS+ S TGC+ Sbjct: 111 KSRRRHRRRSVKLAPSVSGSSVLSSPVSTGCR 142 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,272,660 Number of Sequences: 37544 Number of extensions: 287257 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -