BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0268 (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 24 1.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 24 1.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 1.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 1.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 1.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.0 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 124 PLTPFPPRFIPPDMYRLRP 142 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 372 PLTPFPPRFIPPDMYRLRP 390 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 357 PLTPFPPRFIPPDMYRLRP 375 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 612 PILSTPPKLTPPXRYSLNP 668 P+ PP+ PP Y L P Sbjct: 373 PLTPFPPRFIPPDMYRLRP 391 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 416 LASVYGELLVCFLVIFSC 363 LA V G L+C+L F+C Sbjct: 621 LAIVLGVFLICWLPFFTC 638 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/46 (23%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 206 KLPWNANSVILGTS*TDIRS-PFGRKACIFTSGI*AYDIFINKIRH 72 ++ W ++ + D+ PF + C+ G YD F +RH Sbjct: 136 RVEWKPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRH 181 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 146 PFGRKACIFTSGI*AYDIFINKIRH 72 PF + C+ G YD F +RH Sbjct: 161 PFDEQTCVLKFGSWTYDGFKVDLRH 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,403 Number of Sequences: 438 Number of extensions: 3344 Number of successful extensions: 24 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -